PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008229937.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 385aa    MW: 43220.1 Da    PI: 6.4503
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008229937.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.73.5e-47171411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     + pGfrF+Ptdeel+++yLk+k+eg +         vdi+++ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+ gyWkatgk+++v+s
  XP_008229937.2  17 MFPGFRFSPTDEELISYYLKNKLEGPEPGX---XXXVDICNFEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSRRATEFGYWKATGKERNVKS 108
                     579**********************99666...689************667777899************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++++g+k+tLvf+ grapkge+t+W+mhey +
  XP_008229937.2 109 -TSNVIGTKRTLVFHMGRAPKGERTEWIMHEYCM 141
                     .999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-527156IPR003441NAC domain
PROSITE profilePS5100551.64517157IPR003441NAC domain
PfamPF023659.4E-2619140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MGAVSKEAQL SIAVSSMFPG FRFSPTDEEL ISYYLKNKLE GPEPGXXXXV DICNFEPWDL  60
PAKSVIQSDN EWFFFSPRGR KYPNGSQSRR ATEFGYWKAT GKERNVKSTS NVIGTKRTLV  120
FHMGRAPKGE RTEWIMHEYC MNDKSQDSIV VCRLRKNSDF HLNDTTNGGS SSRNPLSTVH  180
NSENAVSEVG IDHDKPVECY SKKSTSSHDS HSTEQIDSAS ESNQKQTTEV TQTESTGHRK  240
GSYDDDFYAD ILNDDIIKLD EVSVSASADT LPVLANKSED EQNSHQPMQA ICNSEAIPFQ  300
GTANRRIHLR KRKEKFPAGS LEGPNSQESP KTSADRMDDQ HVLLYVIIII LVLLALFLSK  360
FCFTDIAGSV SFLVERFLSS QKHHK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-391615716165NO APICAL MERISTEM PROTEIN
1ut4_B9e-391615716165NO APICAL MERISTEM PROTEIN
1ut7_A9e-391615716165NO APICAL MERISTEM PROTEIN
1ut7_B9e-391615716165NO APICAL MERISTEM PROTEIN
4dul_A9e-391615716165NAC domain-containing protein 19
4dul_B9e-391615716165NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1309314RKRKEK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008229937.10.0PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 89-like
TrEMBLM5WBR10.0M5WBR1_PRUPE; Uncharacterized protein
STRINGGLYMA13G39090.21e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.11e-87NTM1-like 8